The domain within your query sequence starts at position 92 and ends at position 164; the E-value for the DEAD domain shown below is 1.3e-9.
FEWQAECLLLGHVLEGKNLVYSAPTSAGKTLVAELLILKRVLETRKKALFILPFVSVAKE KKCYLQRPNSNQA
DEAD |
---|
PFAM accession number: | PF00270 |
---|---|
Interpro abstract (IPR011545): | Proteins with this domain include the DEAD and DEAH box helicases. Helicases are involved in unwinding nucleic acids. The DEAD box helicases are involved in various aspects of RNA metabolism, including nuclear transcription, pre mRNA splicing, ribosome biogenesis, nucleocytoplasmic transport, translation, RNA decay and organellar gene expression. |
GO function: | ATP binding (GO:0005524), nucleic acid binding (GO:0003676) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DEAD