The domain within your query sequence starts at position 229 and ends at position 282; the E-value for the DEK_C domain shown below is 9.5e-20.
TERLIKAKLRSIMMSQDLENVTSKEIRNELEKQMNCNLKEFKEFIDNEMLLILG
DEK_C |
---|
PFAM accession number: | PF08766 |
---|---|
Interpro abstract (IPR014876): | DEK is a chromatin associated protein that is linked with cancers and autoimmune disease. This domain is found at the C-terminal of DEK and is of clinical importance since it can reverse the characteristic abnormal DNA-mutagen sensitivity in fibroblasts from ataxia-telangiectasia (A-T) patients [ (PUBMED:7504406) ]. The structure of this domain shows it to be homologous to the E2F/DP transcription factor family [ (PUBMED:15238633) ]. This domain is also found in chitin synthase proteins like Q8TF96 and in protein phosphatases such as Q6NN85 . |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DEK_C