The domain within your query sequence starts at position 532 and ends at position 838; the E-value for the DHO_dh domain shown below is 8.1e-36.
DISVEMAGLRFPNPFGLASATPATSTPMIRRAFEAGWGFALTKTFSLDKDIVTNVSPRII RGTTSGPLYGPGQSSFLNIELISEKTAAYWCHSVTELKADFPDNILIASIMCSYNKSDWM ELSKMAEASGADALELNLSCPHGMGERGMGLACGQDPELVRNICRWVRQAVRVPFFAKLT PNVTDIVSIARAAKEGGADGVTATNTVSGLMGLKADGTPWPAVGIGRRTTYGGVSGTAIR PIALRAVTAIARALPGFPILATGGIDSAESGLQFLHSGASVLQVCSAIQNQDFTVIEDYC TGLKALL
DHO_dh |
---|
PFAM accession number: | PF01180 |
---|---|
Interpro abstract (IPR005720): | Dihydroorotate dehydrogenase ( EC 1.3.3.1 ) (DHOdehase) catalyzes the fourth step in the de novo biosynthesis of pyrimidine, the conversion of dihydroorotate into orotate. DHOdehase is a ubiquitous FAD flavoprotein. In bacteria (gene pyrD), DHOdease is located on the inner side of the cytosolic membrane. In some yeasts, such as in Saccharomyces cerevisiae (gene URA1, subfamily 2), it is a cytosolic protein while in other eukaryotes it is found in the mitochondria [ (PUBMED:1409592) ]. This entry represents a domain found in the type I dihydroorotate dehydrogenases and dihydropyrimidine dehydrogenase. |
GO process: | oxidation-reduction process (GO:0055114) |
GO component: | cytoplasm (GO:0005737) |
GO function: | oxidoreductase activity, acting on the CH-CH group of donors (GO:0016627) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DHO_dh