SMART: Pfam domain DHR-2

The domain within your query sequence starts at position 1133 and ends at position 1635; the E-value for the DHR-2 domain shown below is 6.4e-99.

QCEFNLSGNGNFHMFENELITKLDQEVEGGRGDEQYKVLLEKLLLEHCRKHKYLANSGEA
FAFLVSSLLENLLDYRTIIIHDESKENRMSCTVNVLNFYKDKKREDIYIRYLYKLRDLHR
DCENYTEAAYTLLLHAELLQWSDKPCVPHLLQRDSYYVYTQQELKEKLYQEIISYFDKGK
MWEKAIKLSKELAETYESKVFDYEGLGSLLKKRALFYENIIKAMRPQPEYFAVGYYGQGF
PSFLRNKIFIYRGKEYERREDFSLRLLTQFPNAEKMTSTTPPGEDIKSSPKQYLQCFTVK
PVMSLPPSYKDKPVPEQILNYYRANEVQQFSYSRPFRKGEKDPENEFATMWIERTTYRTA
YTFPGILKWFEAKEISVEEISPLENAIETMELTNERVSNCVQQHAWDHSLSVHPLSMLLS
GIVDPAVMGGFSNYEKAFFTEKYLQEHPEDQEKVELLKRLIALQIPLLTEGIRIHGEKLT
EQLKPLHARLSSCFRELKEKVEK

DHR-2

PFAM accession number:	PF06920
Interpro abstract (IPR010703):	This entry represents a conserved region of approximately 200 residues within a number of eukaryotic dedicator of cytokinesis (DOCK) proteins. These proteins are potential guanine nucleotide exchange factors that activate some small GTPases, such as Rac, by exchanging bound GDP for free GTP [ (PUBMED:12432077) ]. DOCK proteins are required during several cellular processes, such as cell motility and phagocytosis. For instance, DOCK2 is specifically expressed in haemopoietic cells, and plays a critical role in lymphocyte migration [ (PUBMED:12829596) ]. This region interacts with RAC1 and ELMO1 [ (PUBMED:22331897) ].

PFAM accession number:

PF06920

Interpro abstract (IPR010703):

This entry represents a conserved region of approximately 200 residues within a number of eukaryotic dedicator of cytokinesis (DOCK) proteins. These proteins are potential guanine nucleotide exchange factors that activate some small GTPases, such as Rac, by exchanging bound GDP for free GTP [ (PUBMED:12432077) ]. DOCK proteins are required during several cellular processes, such as cell motility and phagocytosis. For instance, DOCK2 is specifically expressed in haemopoietic cells, and plays a critical role in lymphocyte migration [ (PUBMED:12829596) ]. This region interacts with RAC1 and ELMO1 [ (PUBMED:22331897) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DHR-2