The domain within your query sequence starts at position 52 and ends at position 107; the E-value for the DLIC domain shown below is 3.2e-5.
LQETVSAISSALGGIEKAPLNIAVMGETGAGKSSLINALQGVGDDEEGAAASTGVV
DLIC |
![]() |
---|
PFAM accession number: | PF05783 |
---|---|
Interpro abstract (IPR022780): | This entry consists of several eukaryotic dynein light intermediate chain proteins. The light intermediate chains (LICs) of cytoplasmic dynein consist of multiple isoforms, which undergo post-translational modification to produce a large number of species. DLIC1 is known to be involved in assembly, organisation, and function of centrosomes and mitotic spindles when bound to pericentrin [ (PUBMED:10545494) (PUBMED:10893222) ]. DLIC2 is a subunit of cytoplasmic dynein 2 that may play a role in maintaining Golgi organisation by binding cytoplasmic dynein 2 to its Golgi-associated cargo [ (PUBMED:11907264) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DLIC