The domain within your query sequence starts at position 1 and ends at position 503; the E-value for the DMP1 domain shown below is 9.8e-206.

MKTVILLVFLWGLSCALPVARYHNTESESSEERTGDLAGSPPPPTNSESSEESQASPEGQ
ANSDHTDSSESGEELGYDRGQYRPAGGLSKSTGTGADKEDDEDDSGDDTFGDEDNDLGPE
EGQWGGPSKLDSDEDSTDTTQSSEDSTSQENSAQDTPSDSKDHDSEDEADSRPEAGDSTQ
DSESEEQRVGGGSEGESSHGDGSEFDDEGMQSDDPESTRSDRGHARMSSAGIRSEESKGD
HEPTSTQDSDDSQSVEFSSRKSFRRSHVSEEDYRGELTDSNSRETQSDSTEDTASKEESR
SESQEDTAESQSQEDSPEGQDPSSESSEEAGEPSQESSSESQEGVTSESRGDNPDNTSQA
GDQEDSESSEEDSLNTFSSSESQSTEEQADSESNESLSLSEESQESAQDGDSSSQEGLQS
QSASTESRSQESQSEQDSRSEEDSDSQDSSRSKEESNSTGSASSSEEDIRPKNMEADSRK
LIVDAYHNKPIGDQDDNDCQDGY

DMP1

 DMP1
PFAM accession number:PF07263
Interpro abstract (IPR009889):

This family consists of several mammalian dentin matrix protein 1 (DMP1) sequences. The dentin matrix acidic phosphoprotein 1 (DMP1) gene has been mapped to human chromosome 4q21 [ (PUBMED:9177774) ]. DMP1 is a bone and teeth specific protein initially identified from mineralised dentin. DMP1 is primarily localised in the nuclear compartment of undifferentiated osteoblasts. In the nucleus, DMP1 acts as a transcriptional component for activation of osteoblast-specific genes like osteocalcin. During the early phase of osteoblast maturation, Ca 2+ surges into the nucleus from the cytoplasm, triggering the phosphorylation of DMP1 by a nuclear isoform of casein kinase II. This phosphorylated DMP1 is then exported out into the extracellular matrix, where it regulates nucleation of hydroxyapatite. DMP1 is a unique molecule that initiates osteoblast differentiation by transcription in the nucleus and orchestrates mineralised matrix formation extracellularly, at later stages of osteoblast maturation [ (PUBMED:12615915) ]. The DMP1 gene has been found to be ectopically expressed in lung cancer although the reason for this is unknown [ (PUBMED:12929940) ].

GO process:extracellular matrix organization (GO:0030198), ossification (GO:0001503)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DMP1