The domain within your query sequence starts at position 18 and ends at position 196; the E-value for the DNA_alkylation domain shown below is 4.6e-8.
LKAELNNEKKEKRKEAVKKVIAAMTVGKDVSSLFPDVVNCMQTDNLELKKLVYLYLMNYA KSQPDMAIMAVNSFVKDCEDPNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYV RKTAAVCVAKLHDINAQMVEDQGFLDSLRDLIADSNPMVVANAVAALSEISESHPNSNL
DNA_alkylation |
![]() |
---|
PFAM accession number: | PF08713 |
---|---|
Interpro abstract (IPR014825): | These proteins are predicted to be DNA alkylation repair enzymes. The structure of a hypothetical protein shows it to adopt a super coiled alpha helical structure. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DNA_alkylation