The domain within your query sequence starts at position 1 and ends at position 92; the E-value for the DPM3 domain shown below is 2.3e-34.
MTKLTQWLWGLALLGSAWAALTMGALGLELPFPCREVLWPLPAYLLVSAGCYALGTVGYR VATFHDCEDAARELQSQIVEARADLARRGLRF
DPM3 |
![]() |
---|
PFAM accession number: | PF08285 |
---|---|
Interpro abstract (IPR013174): | This family corresponds to subunit 3 of dolichol-phosphate mannosyltransferase, an enzyme which generates mannosyl donors for glycosylphosphatidylinositols, N-glycan and protein O- and C-mannosylation. DPM3 is an integral membrane protein and plays a role in stabilising the dolichol-phosphate mannosyl transferase complex [ (PUBMED:10835346) ]. |
GO process: | protein glycosylation (GO:0006486) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DPM3