The domain within your query sequence starts at position 13 and ends at position 153; the E-value for the DSPn domain shown below is 1.6e-66.
EFMKDRLYFATLRNRPKSTINIHYFSIDEELVYENFYADFGPLNLAMVYRYCCKLNKKLK SYSLSRKKIVHYTSFDQRKRANAAFLIGAYAVIYLKKTPEEAYRALLSGSNPPYLPFRDA SFGNCTYNLTVLDCLQGIRKG
DSPn |
---|
PFAM accession number: | PF14671 |
---|---|
Interpro abstract (IPR029260): | The active core of the dual specificity protein phosphatase is made up of two globular domains both with the DSP-like fold. This domain represents the N-terminal half of the core (DSPn). These domains are arranged in tandem, and are associated via an extensive interface to form a single globular whole. The conserved PTP signature motif (Cys-[X]5-Arg) that defines the catalytic centre of all PTP-family members is located within the C-terminal domain, DSPc . Although the centre of the catalytic site is formed from DSPc, two loops from the N-terminal domain, DSPn, also contribute to the catalytic site, facilitating peptide substrate specificity [ (PUBMED:12853468) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DSPn