The domain within your query sequence starts at position 50 and ends at position 183; the E-value for the DUF1057 domain shown below is 3.9e-9.
WKTSGKFFTYKGLRIFYQDSVGVVGSPEIVVLLHGFPTSSYDWYKIWEGLTLRFHRVIAL DFLGFGFSDKPRPHQYSIFEQASIVESLLRHLGLQNRRINLLSHDYGDIVAQELLYRYKQ NRSGRLTIKSLCLS
DUF1057 |
![]() |
---|
PFAM accession number: | PF06342 |
---|---|
Interpro abstract (IPR010463): | This entry consists of proteins of unknown function which have an alpha/beta hydrolase fold. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1057