The domain within your query sequence starts at position 945 and ends at position 1059; the E-value for the DUF1081 domain shown below is 9.4e-32.
ENRQSWSTCKPLFTGMNYCTTGAYSNASSTESASYYPLTGDTRYELELRPTGEVEQYSAT ATYELLKEDKSLVDTLKFLVQAEGVQQSEATVLFKYNRRSRTLSSEVLIPGFDVN
DUF1081 |
![]() |
---|
PFAM accession number: | PF06448 |
---|---|
Interpro abstract (IPR009454): | This entry represents a conserved open beta-sheet domain found in several lipid transport proteins, including vitellogenin and apolipoprotein B-100 [ (PUBMED:9687371) ]. Vitellinogen precursors provide the major egg yolk proteins that are a source of nutrients during early development of oviparous vertebrates and invertebrates. Vitellinogen precursors are multi-domain apolipoproteins that are cleaved into distinct yolk proteins. Different vitellinogen precursors exist, which are composed of variable combinations of yolk protein components; however, the cleavage sites are conserved. In vertebrates, a complete vitellinogen is composed of an N-terminal signal peptide for export, followed by four regions that can be cleaved into yolk proteins: heavy chain lipovitellin (lipovitellin-1), phosvitin, light chain lipovitellin (lipovitellin-2), and a von Willebrand factor type D domain (YGP40) [ (PUBMED:17314313) (PUBMED:12135361) ]. In vitellinogen, this domain is often found as part of the lipovitellin-1 peptide product. Apolipoprotein B can exist in two forms: B-100 and B-48. Apoliporotein B-100 is present on several lipoproteins, including very low-density lipoproteins (VLDL), intermediate density lipoproteins (IDL) and low density lipoproteins (LDL), and can assemble VLDL particles in the liver [ (PUBMED:16238675) ]. Apolipoprotein B-100 has been linked to the development of atherosclerosis. |
GO process: | lipid transport (GO:0006869) |
GO function: | lipid transporter activity (GO:0005319) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1081