The domain within your query sequence starts at position 16 and ends at position 99; the E-value for the DUF1151 domain shown below is 2.8e-35.
MARPEYREWNSELIKPKKLLNPVKASRSHQELHRELLMNHKRGLGMDSKPELQRVLEHRR RNQLIKKKEEELEAKRMQCPFKQE
DUF1151 |
---|
PFAM accession number: | PF06625 |
---|---|
Interpro abstract (IPR009533): | This entry includes FAM107A/B. FAM107A (also known as DRR1) is an actin-associated protein that plays important roles in tumor cell growth, neuron survival and spine formation [ (PUBMED:28604741) ]. The function of FAM107B is not clear. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1151