The domain within your query sequence starts at position 903 and ends at position 946; the E-value for the DUF1154 domain shown below is 1.3e-7.

TEVEAQTIEELKQQKSFVKLQKKHYKEMKDLVKRHHKKTTELIK

DUF1154

• PFAM accession number: PF06631
• Interpro abstract (IPR009535):

  This entry represents group a small conserved region found in 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta, also known as phospholipase C beta (PLC-beta) [ (PUBMED:11118617) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1154