The domain within your query sequence starts at position 903 and ends at position 946; the E-value for the DUF1154 domain shown below is 1e-9.
TEVEAQTIEELKQQKSFVKLQKKHYKEMKDLVKRHHKKTTELIK
DUF1154 |
![]() |
---|
PFAM accession number: | PF06631 |
---|---|
Interpro abstract (IPR009535): | This entry represents group a small conserved region found in 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta, also known as phospholipase C beta (PLC-beta) [ (PUBMED:11118617) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1154