The domain within your query sequence starts at position 7 and ends at position 153; the E-value for the DUF1180 domain shown below is 7.1e-46.
QPPPPLLLLLLALLAAPAALARRAESASASQPEAEHQPPPGPGNATQLGSGMAGGGSSNS SVDAVVTRISSLLRDLPTLKATVIVACAFSALLIACLLLRVFRLGKRLKKTRKYDIITTP AERVEMAPLNEEDDEDEDSTVFDIKYR
DUF1180 |
---|
PFAM accession number: | PF06679 |
---|---|
Interpro abstract (IPR009565): | This entry consists of several hypothetical eukaryotic proteins thought to be membrane proteins. Their function is unknown. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1180