The domain within your query sequence starts at position 32 and ends at position 121; the E-value for the DUF1211 domain shown below is 5.4e-23.
RMLGFSDALLSIIATVMILPVTHTEISPEQQFDKSIQKLLATRIAVYLMTFLIVTVAWTA HTRLFQVVGKIDDTLALLNLACMMTITLLP
DUF1211 |
![]() |
---|
PFAM accession number: | PF06736 |
---|---|
Interpro abstract (IPR010617): | In animals, TMEM175 is an organelle-specific potassium channel specifically responsible for potassium conductance in endosomes and lysosomes. It forms a potassium-permeable leak-like channel, which regulates lumenal pH stability and is required for autophagosome-lysosome fusion. TMEM175 is the major lysosomal K+ conductance [ (PUBMED:26317472) ]. This entry also includes TMEM175 homologues from bacteria and archaea. |
GO function: | potassium channel activity (GO:0005267) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1211