The domain within your query sequence starts at position 230 and ends at position 267; the E-value for the DUF1232 domain shown below is 4.9e-13.

IMLCLMGAFFYLISPLDFVPEALFGILGFLDDFFVIFL

DUF1232

 DUF1232
PFAM accession number:PF06803
Interpro abstract (IPR010652):

This domain can be found in RNF170 from eukaryotes and some uncharacterised proteins from bacteria and archaea. RNF170 is an E3 ubiquitin-protein ligase that plays an essential role in stimulus-induced inositol 1,4,5-trisphosphate receptor type 1 (ITPR1) ubiquitination and degradation via the endoplasmic reticulum-associated degradation (ERAD) pathway [ (PUBMED:21610068) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1232