SMART: Pfam domain DUF1308

The domain within your query sequence starts at position 38 and ends at position 401; the E-value for the DUF1308 domain shown below is 2.2e-115.

LCSKLKAELKFLQKIEAGKVAIKESHLQSTNLTHLKAIVESAENLEEVVSVLRVFGYTDT
LGEKQTLVVDVVANGGHTWVKAIGRKAEALHNIWLGRGQYGDKSIIEQAEDFLQASRQQP
VQYSNPHIVFAFYNSVSSPMADKLKDMGISVRGDIVAVNSLLNHPEEFQLSESESDDEGQ
ELLQVTRVDRDNVLARVAFPTEIKVDVCKKVNLDITTLITYVSAMSYGGCHFVFKEKVLT
EQAEQERKERVLPQLEAFMKDKELFACESAVKDFQSILDTLGGPGERERADVLIKRISVV
PDQPSERALRLVASSKINSRSLTIFGTGDTLKAITMTANSGFVRAANNQGVKFSVFIHQP
RALT

DUF1308

PFAM accession number:	PF07000
Interpro abstract (IPR010733):	This is a domain of unknown function found on the C-terminal of C7orf25 protein UPF0415. The C-terminal domain is homologous to the known PIN-like domains. The PIN-like domain is widespread among eukaryotes, including animals, plants, and fungi, but also present in some cyanobacteria, Deinococcus, and dsDNA viruses from the Mimiviridae family. The domain retains up to four potential catalytic residues, thus, depending on the protein is predicted to be an active or inactive nuclease and in a majority of the family members, the PIN-like domain is N-terminally fused with a potentially active PD-(D/E)XK-like domain Pfam:PF18474 [ (PUBMED:28575517) ].

PFAM accession number:

PF07000

Interpro abstract (IPR010733):

This is a domain of unknown function found on the C-terminal of C7orf25 protein UPF0415. The C-terminal domain is homologous to the known PIN-like domains. The PIN-like domain is widespread among eukaryotes, including animals, plants, and fungi, but also present in some cyanobacteria, Deinococcus, and dsDNA viruses from the Mimiviridae family. The domain retains up to four potential catalytic residues, thus, depending on the protein is predicted to be an active or inactive nuclease and in a majority of the family members, the PIN-like domain is N-terminally fused with a potentially active PD-(D/E)XK-like domain Pfam:PF18474 [ (PUBMED:28575517) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1308