The domain within your query sequence starts at position 158 and ends at position 288; the E-value for the DUF1325 domain shown below is 5.2e-43.
PGDKVAARVKAVEGDEQWILAEVVSYSHATNKYEVDDIDEEGKERHTLSRRRIIPLPQWK ANPETDPEALFQKEQLVLALYPQTTCFYRALIHTPPQRPQDDYSVLFEDTSYADGYSPPL NVAQRYVVACK
DUF1325 |
![]() |
---|
PFAM accession number: | PF07039 |
---|---|
Interpro abstract (IPR010750): | SAGA-associated factor 29 is involved in transcriptional regulation, probably through association with histone acetyltransferase (HAT) complexes like the TFTC-HAT or STAGA complexes. It also may be involved in MYC-mediated oncogenic transformation. It is a component of the ATAC complex, which is a complex with histone acetyltransferase activity on histones H3 and H4 [ (PUBMED:19103755) ]. This entry represents a domain found in yeast and human SAGA-associated factor 29 proteins that is related to the tudor domain. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1325