The domain within your query sequence starts at position 11 and ends at position 156; the E-value for the DUF1356 domain shown below is 8.4e-57.
RKDEDKPILPDNPAMASQAANYFSTGSSKPAHSCMPYEKAASSSFVTCPTCQGNGEIPQE QEKQLVALIPYGDQRLKPRRTKLFVFLSVAICLLIFSLTIFFLYPRPIAVRPVGLNSSTV TFEDAHVQLNTTNVLNIFNSNFYPIT
DUF1356 |
---|
PFAM accession number: | PF07092 |
---|---|
Interpro abstract (IPR009790): | This family consists of several hypothetical mammalian proteins of around 250 residues in length. The function of this family is unknown. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1356