The domain within your query sequence starts at position 7 and ends at position 157; the E-value for the DUF1438 domain shown below is 1.8e-95.
MMQSIPSFVKDTSDIEEHALPTAQVLPAQSTRCSKSETLCFSKEQSHCSEDGWIAEWDLY SFCVFESVDYLRSYRRLNSAMKKGTEVFQSESQRKPQVSPGDVENYKDKDTEEPDQPFPS LLREKGLDLATCDGGDCPDQDPVSDNSRHLG
DUF1438 |
---|
PFAM accession number: | PF07270 |
---|---|
Interpro abstract (IPR009895): | This family consists of several hypothetical proteins of around 170 residues in length, which appear to be mouse specific. The function of this family is unknown. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1438