The domain within your query sequence starts at position 31 and ends at position 116; the E-value for the DUF1604 domain shown below is 2.1e-39.
PIPLQDQTVRDEKGRYKRFHGAFSGGFSAGYFNTVGSKEGWTPSTFVSSRQNRADKSALG PEDFMDEEDLSEFGIAPKAIVTTDDF
DUF1604 |
![]() |
---|
PFAM accession number: | PF07713 |
---|---|
Interpro abstract (IPR011666): | This domain is found at the N terminus of several eukaryotic RNA processing proteins, including Arabidopsis TGH, which is involved in microRNA (miRNA) and small interfering RNA (siRNA) biogenesis [ (PUBMED:22802657) ]. |
GO process: | mRNA processing (GO:0006397) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1604