SMART: Pfam domain DUF1624

The domain within your query sequence starts at position 260 and ends at position 434; the E-value for the DUF1624 domain shown below is 6.8e-11.

RLRCVDTFRGLALVLMVFVNYGGGKYWYFKHSSWNGLTVADLVFPWFVFIMGTSIFLSMT
SILQRGCSKLKLLGKIVWRSFLLICIGVIIVNPNYCLGPLSWDKVRIPGVLQRLGVTYFV
VAVLEFFFWKPVPDSCTLESSCFSLRDITSSWPQWLTILTLESIWLALTFFLPVP

DUF1624

PFAM accession number:	PF07786
Interpro abstract (IPR012429):	This entry represents the catalytic domain of HGSNAT which contains the conserved histidine in the active site (His269), thought to hold the acetyl group during the transfer across the membrane and required for its enzymatic activity [ (PUBMED:20650889) ]. Heparan sulfate acetyl-CoA:alpha-glucosaminide N-acetyltransferase (HGSNAT) catalyzes the transmembrane acetylation of heparan sulfate in lysosomes required for its further catabolism. Mutations of the HGSNAT gene cause the neurodegenerative disease mucopolysaccharidosis IIIC (MPS IIIC) [ (PUBMED:20650889) ].

PFAM accession number:

PF07786

Interpro abstract (IPR012429):

This entry represents the catalytic domain of HGSNAT which contains the conserved histidine in the active site (His269), thought to hold the acetyl group during the transfer across the membrane and required for its enzymatic activity [ (PUBMED:20650889) ].

Heparan sulfate acetyl-CoA:alpha-glucosaminide N-acetyltransferase (HGSNAT) catalyzes the transmembrane acetylation of heparan sulfate in lysosomes required for its further catabolism. Mutations of the HGSNAT gene cause the neurodegenerative disease mucopolysaccharidosis IIIC (MPS IIIC) [ (PUBMED:20650889) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1624