The domain within your query sequence starts at position 55 and ends at position 104; the E-value for the DUF1674 domain shown below is 4.6e-25.
DSLEDSPEEREPLQKFPDDVNPVTKEKGGPKGPEPTRYGDWERKGRCIDF
DUF1674 |
---|
PFAM accession number: | PF07896 |
---|---|
Interpro abstract (IPR012875): | This entry includes SDHF4 from animals, Sdh8 from budding yeasts and some uncharacterised proteins from bacteria. Sdh8 is required for assembly of succinate dehydrogenase (SDH). It interacts with the catalytic Sdh1 subunit in the mitochondrial matrix, facilitating its association with Sdh2 and the subsequent assembly of the SDH holocomplex [ (PUBMED:24954416) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1674