The domain within your query sequence starts at position 247 and ends at position 321; the E-value for the DUF1736 domain shown below is 7.3e-33.
GNKPPSFSNSDNPAADSDSLLARTLTFLYLPTKNLWLLLCPDTLSFDWSMDAVPLLKTVC DWRNLHTVAFYSGLL
DUF1736 |
 |
|---|
| PFAM accession number: | PF08409 |
|---|---|
| Interpro abstract (IPR013618): | This domain of unknown function is found in various hypothetical metazoan proteins. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1736