The domain within your query sequence starts at position 13 and ends at position 48; the E-value for the DUF1744 domain shown below is 2.7e-13.
EVHFIHSKEIFHSLTISFSRCWEFLLWMDPSNYGGI
DUF1744 |
 |
|---|
| PFAM accession number: | PF08490 |
|---|---|
| Interpro abstract (IPR013697): | This domain is found on the catalytic subunit of DNA polymerase epsilon. It is found C-terminal to IPR006133 and IPR006134 . |
| GO process: | DNA replication (GO:0006260) |
| GO component: | nucleus (GO:0005634) |
| GO function: | zinc ion binding (GO:0008270), DNA-directed DNA polymerase activity (GO:0003887) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1744