The domain within your query sequence starts at position 9 and ends at position 162; the E-value for the DUF1794 domain shown below is 1.5e-42.
VVEPLSWMLGTWLSDPPGVGTFPTLQPFQYLEEVHISHVGQPMLNFSFNSFHPETHKPMH RECGFIRLKPDTNKVAFVSAQNTGIVEVEEGEVNGQELCVSSHSVSRISFAKEPHVEQIT RKFRLNSEGKLEQTVSMATTTQPMTQHLHITYKK
DUF1794 |
---|
PFAM accession number: | PF08768 |
---|---|
Interpro abstract (IPR014878): | Nitrobindin is a heme-containing lipocalin that may reversibly bind nitric oxide. This heme-binding domain forms a beta barrel structure, and in a small family of proteins from tetrapods, it is found C-terminal to a THAP zinc finger domain (a sequence-specific DNA binding domain). Members of this group are putatively related to fatty acid-binding proteins (FABPs) [ (PUBMED:17172346) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1794