The domain within your query sequence starts at position 203 and ends at position 342; the E-value for the DUF1992 domain shown below is 4.7e-25.

LVEDLIQESMAKGDFDNLSGKGKPLKKFSGCSYIDPMTHNLNRILIDNGYQPEWILMQKE
IKDTIEQLREALLMSRKKLGNPLSPTEQKQWAQVCEQFQEKIRKLNKRINDFNLIVPILT
RQKVHFDAQKEIIRVQEMYG

DUF1992

 DUF1992
PFAM accession number:PF09350
Interpro abstract (IPR018961):

This entry represents a family of proteins that may have a role in protein folding or as a chaperone. DnaJ is a member of the J-protein family, which are defined by the presence of a J domain that can regulate the activity of 70kDa heat-shock proteins [ (PUBMED:15170475) ]. Some of the proteins in this entry contain a J domain.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1992