The domain within your query sequence starts at position 227 and ends at position 295; the E-value for the DUF1992 domain shown below is 1.2e-24.
LVEDLIQESMAKGDFDNLSGKGKPLKKFSGCSYIDPMTHNLNRILIDNGYQPEWILMQKE IKDTIEQLR
DUF1992 |
![]() |
---|
PFAM accession number: | PF09350 |
---|---|
Interpro abstract (IPR018961): | This entry represents a family of proteins that may have a role in protein folding or as a chaperone. DnaJ is a member of the J-protein family, which are defined by the presence of a J domain that can regulate the activity of 70kDa heat-shock proteins [ (PUBMED:15170475) ]. Some of the proteins in this entry contain a J domain. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF1992