SMART: Pfam domain DUF2013

The domain within your query sequence starts at position 539 and ends at position 675; the E-value for the DUF2013 domain shown below is 5e-36.

TEQLPDLCMNLLLALNLHLTAPEQNVIMAALSRHTNVKIFSEKLLLLLNRGDDPVRIFRH
EPQPPHSVLKFLQDVFSSSATAAIFYHTDMMALIDITVRQIADLSPGDKLRMEYLSLMHA
VVRSTPYLQHRHRLSDL

DUF2013

PFAM accession number:	PF09431
Interpro abstract (IPR018556):	This domain is found at the C terminus of some proteins, including Ldb17, NCK-interacting protein and uncharacterised proteins. Ldb17 is involved in the regulation of endocytosis in yeast [ (PUBMED:19506040) ]. NCK-interacting protein (also known as WASP-interacting SH3-domain protein) induces microspike formation in vivo. In vitro, stimulates N-WASP-induced ARP2/3 complex activation in the absence of CDC42. It may play an important role in the maintenance of sarcomere and/or in the assembly of myofibrils into sarcomeres. It is also implicated in regulation of actin polymerisation and cell adhesion [ (PUBMED:11157975) ].

PFAM accession number:

PF09431

Interpro abstract (IPR018556):

This domain is found at the C terminus of some proteins, including Ldb17, NCK-interacting protein and uncharacterised proteins. Ldb17 is involved in the regulation of endocytosis in yeast [ (PUBMED:19506040) ]. NCK-interacting protein (also known as WASP-interacting SH3-domain protein) induces microspike formation in vivo. In vitro, stimulates N-WASP-induced ARP2/3 complex activation in the absence of CDC42. It may play an important role in the maintenance of sarcomere and/or in the assembly of myofibrils into sarcomeres. It is also implicated in regulation of actin polymerisation and cell adhesion [ (PUBMED:11157975) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF2013