The domain within your query sequence starts at position 14 and ends at position 102; the E-value for the DUF2039 domain shown below is 2.9e-35.
QKHQNTFTFKNDKFDKSVQTKKINAKLHDGVCQRCKEVLEWRVKYSKYKPLSKPKKCVKC LQKTVKDSYHIMCRPCACELEVCAKCGKK
DUF2039 |
 |
|---|
| PFAM accession number: | PF10217 |
|---|---|
| Interpro abstract (IPR019351): | This entry is a region of approximately 100 residues containing three pairs of cysteine residues. The region is conserved from plants to humans but its function is unknown. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF2039