The domain within your query sequence starts at position 1 and ends at position 43; the E-value for the DUF2046 domain shown below is 1.1e-22.
XHMREENLRLQRKLQREMERREALCRQLSESESSLEMDDERYF
DUF2046 |
![]() |
---|
PFAM accession number: | PF09755 |
---|---|
Interpro abstract (IPR019152): | This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF2046