The domain within your query sequence starts at position 1 and ends at position 43; the E-value for the DUF2046 domain shown below is 1.1e-22.

XHMREENLRLQRKLQREMERREALCRQLSESESSLEMDDERYF

DUF2046

 DUF2046
PFAM accession number:PF09755
Interpro abstract (IPR019152):

This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF2046