The domain within your query sequence starts at position 2 and ends at position 158; the E-value for the DUF2053 domain shown below is 3.1e-69.
TLFHFGNCFALAYFPYFITYKCSGLSEYNAFWKCVQAGVTYLFVQLCKMLFLATFFPTWE GGIYDFIGEFMKASVDVADLIGLNLVMSRNAGKGEYKIMVAALGWATAELIMSRCIPLWV GARGIEFDWKYIQMSIDSNISLVHYIVASAQVWMITR
DUF2053 |
---|
PFAM accession number: | PF09767 |
---|---|
Interpro abstract (IPR019164): | TMEM147 is a component of the Nicalin-NOMO protein complex, which catalyzes the proteolytic cleavage of the transmembrane domain of various proteins including the beta-amyloid precursor protein and Notch [ (PUBMED:20538592) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF2053