SMART: Pfam domain DUF2151

The domain within your query sequence starts at position 1 and ends at position 394; the E-value for the DUF2151 domain shown below is 7.2e-171.

XYCRIMYDIFPFKKLVNFIVSDSGAHVLNSWTQEDQNLQELMAALATVGPPNPRADPECC
SILHGLVAAVETLCKITEYQHEARTLLMENAERVGNRGRIICITNAKSDSHVRMLEDCVQ
ETIHEHNKLAANSDHLMQIQKCELVLIHTYPVGEDSLVSDRPKKELSPVLTSEVHSVRAG
RHLATKLNVLVQQHFDLASTTITNIPMKPTFSVFEQEEQHANTSANYDVELLHHKDAHVD
FLRSGDSHSGSSSREGPFKETVTLKWCTPRTNSIELHYCTGAYRISPVDVNSRPSSCLTN
FLLNGRSVLLEQPRKSGSKVISHMLSSHGGEIFLHVLSSSRSILEDPPSISEGCGGRVTD
YRITDFGEFMRENRLTPFLDPRYKIDASLEIPLE

DUF2151

PFAM accession number:	PF10221
Interpro abstract (IPR019355):	This entry represents the cell cycle regulator Mat89b (also known as protein asunder), which plays an evolutionarily conserved role as a crucial regulator of both cell cycle and development [ (PUBMED:15737938) ]. Mat89Bb is a PNG kinase substrate that is essential for S-M cycles of early Drosophila embryogenesis, Xenopus embryonic cell cycles and morphogenesis, and cell division in cultured mammalian cells.

PFAM accession number:

PF10221

Interpro abstract (IPR019355):

This entry represents the cell cycle regulator Mat89b (also known as protein asunder), which plays an evolutionarily conserved role as a crucial regulator of both cell cycle and development [ (PUBMED:15737938) ]. Mat89Bb is a PNG kinase substrate that is essential for S-M cycles of early Drosophila embryogenesis, Xenopus embryonic cell cycles and morphogenesis, and cell division in cultured mammalian cells.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF2151