The domain within your query sequence starts at position 2 and ends at position 82; the E-value for the DUF2205 domain shown below is 1.2e-37.
MNADMDVDAENQVELEEKTRLINQVLELQHTLEDLSARVDAVKEENLKLKSENQVLGQYI ENLMSASSVFQTTDTKSKRK
DUF2205 |
 |
|---|
| PFAM accession number: | PF10224 |
|---|---|
| Interpro abstract (IPR019357): | This entry represents short coiled-coil protein (SCOC). In human, SCOC is required for autophagosome formation during amino acid starvation. It forms a starvation-sensitive trimeric complex with UVRAG (UV radiation resistance associated gene) and FEZ1 and may regulate ULK1 and Beclin 1 complex activities [ (PUBMED:22354037) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF2205