The domain within your query sequence starts at position 1 and ends at position 134; the E-value for the DUF2368 domain shown below is 9.9e-61.
MGFIFSKSMNENMKNQQEFMVTHARLQLERHLTMQNEMRERQMAMQIAWSREFLKYFGTF FGIATISLATGALKRKKPAFLVPIVPLSFIFTYQYDLGYGTLLQRMKSEAEDILETEKTK LELPKGLITFESLE
DUF2368 |
---|
PFAM accession number: | PF10166 |
---|---|
Interpro abstract (IPR019319): | Plg-R(KT) is a receptor for plasminogen and is involved in the plasminogen-dependent regulation of macrophage invasion, chemotactic migration, and recruitment in the inflammatory response [ (PUBMED:21940822) ]. It is essential for mammary lobuloalveolar development and lactation [ (PUBMED:29495105) ]. |
GO process: | positive regulation of plasminogen activation (GO:0010756) |
GO component: | integral component of plasma membrane (GO:0005887) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF2368