The domain within your query sequence starts at position 1 and ends at position 73; the E-value for the DUF2368 domain shown below is 1.2e-28.

MGFIFSKSMNENMKNQQEFMVTHARLQLERHLTMQNEMRERQMAMQIAWSREFLKYFGTF
FGIATISLATGYA

DUF2368

DUF2368
PFAM accession number:PF10166
Interpro abstract (IPR019319):

Plg-R(KT) is a receptor for plasminogen and is involved in the plasminogen-dependent regulation of macrophage invasion, chemotactic migration, and recruitment in the inflammatory response [ (PUBMED:21940822) ]. It is essential for mammary lobuloalveolar development and lactation [ (PUBMED:29495105) ].

GO process:positive regulation of plasminogen activation (GO:0010756)
GO component:integral component of plasma membrane (GO:0005887)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF2368