The domain within your query sequence starts at position 3 and ends at position 81; the E-value for the DUF2439 domain shown below is 3.7e-23.

CQEFIVLYTHQKMKKSKVWQDGVLKITHLGNKAILYDDKGACLESLFLKCLEVKPGDDLE
SERYLITVEEAKAVGSRAV

DUF2439

DUF2439
PFAM accession number:PF10382
Interpro abstract (IPR018838):

This domain is found at the N-terminal of DNA repair and recombination protein Rdh54 from Saccharomyces cerevisiae. Rdh54 is a member of the Swi2/Snf2 protein family that is needed for mitotic and meiotic interhomologue recombination and DNA repair [ (PUBMED:16831867) ].

Proteins containing this domain also include ZGRF1 from mammals. The funciton of ZGRF1 is not clear.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF2439