The domain within your query sequence starts at position 723 and ends at position 933; the E-value for the DUF2451 domain shown below is 2.6e-90.
LYGLAERVVATESLVFLAEQFEFLQPHLDAVMPAVKKPFLQQFYSQTVSTASELRKPIYW IVAGKAIDYEQMLLLMMNVKWDVKEIMSQHNIYVDALLKEFEQFNKRLNEVSKRVRIPLP VSNILWEHCIRLANRTIVEGYANVKKCSNEGRALMQLDFQQFLMKLEKLTDIRPIPDKEF VETYIKAYYLTENDMERWIKEHRVRTRVGVL
DUF2451 |
![]() |
---|
PFAM accession number: | PF10474 |
---|---|
Interpro abstract (IPR019514): | The function of this domain is not known, but it is found at the C terminus of syndetin (VPS50), a unique component of the endosome-associated retrograde protein (EARP) complex. The EARP complex otherwise shares four of its five subunits with the Golgi-associated retrograde protein (GARP) complex. The EARP complex is localized to recycling endosomes where it acts as a tethering complex for recycling of plasma membrane receptors [ (PUBMED:25799061) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF2451