The domain within your query sequence starts at position 37 and ends at position 184; the E-value for the DUF2476 domain shown below is 2.1e-26.
IQPSSWQGQAEISPTSPLGSAVLDMCWKLIRSQPGSFSAPVRDSEDLEYASPSGMPWMNA PDDLDTGLHLSSSSLDGQVPDAWSPSASPVAESCAPWFTWSLKGSMLKPLPDSPLQSLPP SPPPNHQEQSPLSPVRPTRPPCKARRRL
DUF2476 |
---|
PFAM accession number: | PF10630 |
---|---|
Interpro abstract (IPR018903): | This entry represents proline-rich protein 23 (PRR23) family. The funciton of this family is not clear. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF2476