The domain within your query sequence starts at position 64 and ends at position 159; the E-value for the DUF3090 domain shown below is 5.9e-8.
QNRLEGEVAQLNEAHGKTLEELARKHHMAIEAVHSNASRDKIKLQTELEEQYKKEKLSLE EDKNQLQLELESLKQALGDKLTSANQEIGRLQDLVR
DUF3090 |
![]() |
---|
PFAM accession number: | PF11290 |
---|---|
Interpro abstract (IPR021441): | This family of proteins with unknown function appears to be restricted to Actinobacteria. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3090