The domain within your query sequence starts at position 10 and ends at position 88; the E-value for the DUF3128 domain shown below is 4.1e-9.
PRPCEVYRAEWELCRSVGHVLHHYYVHGKRPDCRQWLRDLTNCREWEESRSAEAQRSLCE SEQVRVQAAQKHTLVWALR
DUF3128 |
 |
|---|
| PFAM accession number: | PF11326 |
|---|---|
| Interpro abstract (IPR021475): | This is a group of eukaryotic proteins with no known function. Proteins in this entry include budding yeast Emi1, which is required for transcriptional induction of the early meiotic-specific transcription factor Ime1 [ (PUBMED:12586695) ]. Deletion of Emi1 affects mitochondrial morphology [ (PUBMED:19703468) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3128