The domain within your query sequence starts at position 509 and ends at position 673; the E-value for the DUF3337 domain shown below is 1.1e-49.
VPPHTPVIFGEAGGRTLFRLLCRDSGGETEAMLLNETVPQWVIDITVDKNMPKFNKIPFY LQPHASSGAKTLKKDRLSASDMLQVRKVMEHVYEKIINLDNESQTTSSSNNEKPEQEKEE DIAVLAEEKIELLCQDQVLDPNMDLRTVKHFIWKSGGDLTLHYRQ
DUF3337 |
---|
PFAM accession number: | PF11816 |
---|---|
Interpro abstract (IPR021772): | This entry includes WDR48 from animals, Bun107 from fission yeasts and Duf1 from budding yeasts. WDR48 (also known as UAF1) is a regulator of deubiquitinating complexes [ (PUBMED:18082604) (PUBMED:19075014) (PUBMED:26388029) ]. Bun107 is required for the Ubp9 recruitment to septa and cell tips but also for its enzymatic activity at these specific locations [ (PUBMED:20838651) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3337