The domain within your query sequence starts at position 809 and ends at position 872; the E-value for the DUF3350 domain shown below is 3.3e-31.
ELLPLSPLSPTMEEEPLIIFLSGDEDTEKVEEKKKSKELKSLWKKAIHQQILLLRMEKEN QKLE
DUF3350 |
 |
|---|
| PFAM accession number: | PF11830 |
|---|---|
| Interpro abstract (IPR021785): | This domain is functionally uncharacterised. This domain is found in eukaryotes. This presumed domain is typically between 50 to 64 amino acids in length. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3350