The domain within your query sequence starts at position 17 and ends at position 172; the E-value for the DUF3361 domain shown below is 1.6e-64.
TFATEFINMDGIIVLTRLVESGTKLLSHEMLAFTLTAFLELMDHGIVSWDMVSVTFIKQI AGYVSQPMVDVSILQRSLAILESMVLNSQSLYQKIAEEITVGQLISHLQVSNQEIQTYAI ALINALFLKAPEDKRQDMANAFAQKHLRSIILNHVI
DUF3361 |
---|
PFAM accession number: | PF11841 |
---|---|
Interpro abstract (IPR024574): | This domain is functionally uncharacterised. This domain is found in eukaryotes and predominantly in ELMO (Engulfment and cell motility) proteins where it may play an important role in defining the functions of the ELMO family members and may be functionally linked to the ELMO domain in these proteins [ (PUBMED:23014990) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3361