The domain within your query sequence starts at position 231 and ends at position 398; the E-value for the DUF3381 domain shown below is 1.3e-48.
VTKKKPKAEGYAEGDLTLYHRTSVTDFLRAANPVDFLSKASEISIDDEELAQHPATTEDI RVCCQDIKVLGRKELRSLLNWRTKLRRYVAKKLKEQAKALDISLSSEEEEEGDEEEAVAE TKQAPEEEEEREEEQLNRTLAEMKAQEVAELKRKKKKLLREQRKQRER
DUF3381 |
---|
PFAM accession number: | PF11861 |
---|---|
Interpro abstract (IPR024576): | This uncharacterised domain is found in eukaryotic rRNA methyltransferases like yeast Spb1 and mammalian homologue Ftsj3. Spb1 is required for proper assembly of pre-ribosomal particles during the biogenesis of the 60S ribosomal subunit [ (PUBMED:10556316) (PUBMED:15546625) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3381