The domain within your query sequence starts at position 58 and ends at position 153; the E-value for the DUF3398 domain shown below is 1.5e-32.
VQKKTQILNDCLREMLLFPYDDFQTAILRRQGRYLRSTVPANAEEEAQSLFVTECIKTYN SDWHLVTYKYEDYSGEFRQLPNKVPKLDKLPVHVYE
DUF3398 |
![]() |
---|
PFAM accession number: | PF11878 |
---|---|
Interpro abstract (IPR021816): | DOCK family members are evolutionarily conserved guanine nucleotide exchange factors (GEFs) for Rho-family GTPases [ (PUBMED:12432077) ]. DOCK proteins are required during several cellular processes, such as cell motility and phagocytosis. The N-terminal SH3 domain of the DOCK proteins functions as an inhibitor of GEF, which can be relieved upon its binding to the ELMO1-3 adaptor proteins, after their binding to active RhoG at the plasma membrane [ (PUBMED:25022758) (PUBMED:15723800) ]. DOCK family proteins are categorised into four subfamilies based on their sequence homology: DOCK-A subfamily (DOCK1/180, 2, 5), DOCK-B subfamily (DOCK3, 4), DOCK-C subfamily (DOCK6, 7, 8), DOCK-D subfamily (DOCK9, 10, 11) [ (PUBMED:12432077) ]. This entry represents the N-terminal domain of the DOCK-C subfamily (DOCK 6, 7, 8), DOCK-D subfamily (DOCK 9, 10, 11). |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3398