The domain within your query sequence starts at position 1 and ends at position 86; the E-value for the DUF3456 domain shown below is 7.8e-16.
MDEVEYDITKARQKKTKVGSYRIRPDGTQERKKVPLAQSEAFLIDLLDKVCMRMNDYQLE DDPVTKQKYFRRYAPRKGDKIYKEYK
DUF3456 |
 |
|---|
| PFAM accession number: | PF11938 |
|---|---|
| Interpro abstract (IPR021852): | This presumed domain is functionally uncharacterised. It is found in a number of proteins, including protein canopy homologues and CRELD1 and 2. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3456