The domain within your query sequence starts at position 27 and ends at position 171; the E-value for the DUF3456 domain shown below is 1e-43.
HCGACRALVDELEWEIARVDPKKTIQMGSFRINPDGSQSVVEVPYARSEAHLTELLEEVC DRMKEYGEQIDPSTHRKNYVRVVSRNGESSELDLQGIRIDSDISGTLKFACESIVEEYED ELIEFFSREADNVKDKLCSKRTDLC
DUF3456 |
![]() |
---|
PFAM accession number: | PF11938 |
---|---|
Interpro abstract (IPR021852): | This presumed domain is functionally uncharacterised. It is found in a number of proteins, including protein canopy homologues and CRELD1 and 2. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3456