The domain within your query sequence starts at position 837 and ends at position 920; the E-value for the DUF3481 domain shown below is 3.5e-31.
GEGDKNISRKPGNVLKTLDPILITIIAMSALGVLLGAVCGVVLYCACWHNGMSERNLSAL ENYNFELVDGVKLKKDKLNPQSNY
DUF3481 |
![]() |
---|
PFAM accession number: | PF11980 |
---|---|
Interpro abstract (IPR022579): | This domain of unknown function is located in the C terminus of the eukaryotic neuropilin receptors. There are two completely conserved residues (Y and E) that may be functionally important. Neuropilins are essential multifunctional vertebrate cell surface receptors [ (PUBMED:23116416) ]. They function as receptors for axon guidance factor semaphorin class 3 (Sema3), vascular endothelial growth factor (VEGF) and placenta growth factor-2 (PLGF-2). |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF3481